Human Antibody Versuse Monoclonal Antibody

Monoclonal Anti-Spectrin(alpha and beta) Antibody Antibody

GWB-BBB082 0.1 mg Ask for price

Human Antibody Laboratories manufactures the human antibody versuse monoclonal antibody reagents distributed by Genprice. The Human Antibody Versuse Monoclonal Antibody reagent is RUO (Research Use Only) to test human serum or cell culture lab samples. To purchase these products, for the MSDS, Data Sheet, protocol, storage conditions/temperature or for the concentration, please contact human Antibody. Other Human products are available in stock. Specificity: Human Category: Antibody Group: Versuse Monoclonal

True Blue

1mg Ask for price
Description: True Blue

True Blue

50mg Ask for price
Description: True Blue

True Blue

5mg Ask for price
Description: True Blue

JBS True Blue

300µl
EUR 11.84

JBS True Blue

300 µl
EUR 16
Description: JBS True Blue

True Blue Chloride

100mg
EUR 11200
Description: 71431-30-6

Monoclonal Anti-Spectrin(alpha and beta) Antibody Antibody

0.1 mg Ask for price

Monoclonal antibody for SUR1 and SUR2B

0.1mg
EUR 423.6
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is not conjugated.

Monoclonal antibody for SUR1 and SUR2B

0.1mg
EUR 480
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with ATTO 390.

Monoclonal antibody for SUR1 and SUR2B

0.1mg
EUR 478.8
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with ATTO 488.

Monoclonal antibody for SUR1 and SUR2B

0.1mg
EUR 478.8
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with ATTO 565.

Monoclonal antibody for SUR1 and SUR2B

0.1mg
EUR 478.8
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with ATTO 594.

Versuse Monoclonal information

Monoclonal antibody for Versican

SMC-439D-DY594 0.1mg
EUR 472.8
Description: A monoclonal antibody from clone S351-23 against Mouse Versican. The host species for the production of this antibody is Mouse. The antigen used for immunization is Mouse Fusion protein amino acids 362-585 (glycosaminoglycan alpha domain) of mouse Versican core protein. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), ICC/IF (1:100). This MAb for Versican is conjugated with Dylight 594.

Monoclonal antibody for Versican

SMC-439D-DY633 0.1mg
EUR 466.8
Description: A monoclonal antibody from clone S351-23 against Mouse Versican. The host species for the production of this antibody is Mouse. The antigen used for immunization is Mouse Fusion protein amino acids 362-585 (glycosaminoglycan alpha domain) of mouse Versican core protein. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), ICC/IF (1:100). This MAb for Versican is conjugated with Dylight 633.

Monoclonal antibody for Versican

SMC-439D-P594 0.1mg
EUR 487.2
Description: A monoclonal antibody from clone S351-23 against Mouse Versican. The host species for the production of this antibody is Mouse. The antigen used for immunization is Mouse Fusion protein amino acids 362-585 (glycosaminoglycan alpha domain) of mouse Versican core protein. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), ICC/IF (1:100). This MAb for Versican is conjugated with PE/ATTO 594.

Monoclonal antibody for Versican

SMC-439D-STR 0.1mg
EUR 476.4
Description: A monoclonal antibody from clone S351-23 against Human Versican. The host species for the production of this antibody is Mouse. The antigen used for immunization is Mouse Fusion protein amino acids 362-585 (glycosaminoglycan alpha domain) of mouse Versican core protein. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), ICC/IF (1:100). This MAb for Versican is conjugated with Streptavidin.

Versican Rabbit monoclonal antibody

BS40759 50ul
EUR 298
Description: Rabbit IgG, 1mg/ml in PBS with 0.02% sodium azide, 50% glycerol, pH7.2.

Versican (9A7) Rabbit Monoclonal Antibody

E28M3499 100ul
EUR 295

Versican (6Q14) Rabbit Monoclonal Antibody

E28M2216 100ul
EUR 295

Versican (19Z6) Rabbit Monoclonal Antibody

E28M2303 100ul
EUR 295

Versican (15C15) Rabbit Monoclonal Antibody

E28M5694 100ul
EUR 295

Versican Rabbit Monoclonal Antibody [KD Validated]

E46F62725 40ul
EUR 295

Human CD8 Monoclonal antibody

8A1-100T 100 test
EUR 259.6

Human CD8 Monoclonal antibody

8AC750-100T 100 test
EUR 446.6

Human CD8 Monoclonal antibody

8F1-100T 100 test
EUR 215.6

Human CD8 Monoclonal antibody

8PE1-100T 100 test
EUR 237.6

Human CD8 Monoclonal antibody

8PPC5.5-100T 100 test
EUR 358.6

Human CD9 Monoclonal antibody

9A-100T 100 test
EUR 303.6

Human CD9 Monoclonal antibody

9B-01MG 100 test
EUR 204.6

Human CD9 Monoclonal antibody

9CFB-100T 100 test
EUR 292.6

Human CD9 Monoclonal antibody

9F-100T 100 test
EUR 215.6

Human CD9 Monoclonal antibody

9PE-100T 100 test
EUR 259.6

Human CD9 Monoclonal antibody

9PU-01MG 0,1 mg
EUR 149.6

Human CD2 Monoclonal antibody

2A-100T 100 test
EUR 259.6

Human CD2 Monoclonal antibody

2F-100T 100 test
EUR 215.6

Human CD2 Monoclonal antibody

2PE-100T 100 test
EUR 259.6

Human CD3 Monoclonal antibody

3A1-100T 100 test
EUR 259.6

Human CD3 Monoclonal antibody

3AC750-100T 100 test
EUR 325.6

Human CD3 Monoclonal antibody

3CFB1-100T 100 test
EUR 292.6

Human CD3 Monoclonal antibody

3F1-100T 100 test
EUR 215.6