Human Antibody Versuse Monoclonal Antibody

Monoclonal PP2A alpha and beta Antibody

AMM03147G 0.1ml
EUR 580.8
Description: A Monoclonal antibody against Human PP2A alpha and beta. The antibodies are raised in Mouse. This antibody is applicable in WB, IP

Human Antibody Laboratories manufactures the human antibody versuse monoclonal antibody reagents distributed by Genprice. The Human Antibody Versuse Monoclonal Antibody reagent is RUO (Research Use Only) to test human serum or cell culture lab samples. To purchase these products, for the MSDS, Data Sheet, protocol, storage conditions/temperature or for the concentration, please contact human Antibody. Other Human products are available in stock. Specificity: Human Category: Antibody Group: Versuse Monoclonal

Monoclonal antibody for SUR1 and SUR2B

0.1mg
EUR 471.6
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with Alkaline Phosphatase.

Monoclonal antibody for SUR1 and SUR2B

0.1mg
EUR 477.6
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with APC.

Monoclonal antibody for SUR1 and SUR2B

0.1mg
EUR 564
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with APC/Cy7.

Monoclonal antibody for SUR1 and SUR2B

0.1mg
EUR 474
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with Biotin.

Monoclonal antibody for SUR1 and SUR2B

0.1mg
EUR 495.6
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with Dylight 350.

Monoclonal antibody for SUR1 and SUR2B

0.1mg
EUR 482.4
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with Dylight 405.

Monoclonal antibody for SUR1 and SUR2B

0.1mg
EUR 470.4
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with Dylight 488.

Versuse Monoclonal information

Monoclonal antibody for Versican

SMC-439D-RPE 0.1mg
EUR 475.2
Description: A monoclonal antibody from clone S351-23 against Human Versican. The host species for the production of this antibody is Mouse. The antigen used for immunization is Mouse Fusion protein amino acids 362-585 (glycosaminoglycan alpha domain) of mouse Versican core protein. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), ICC/IF (1:100). This MAb for Versican is conjugated with RPE.

Monoclonal antibody for Versican

SMC-439D-STR 0.1mg
EUR 476.4
Description: A monoclonal antibody from clone S351-23 against Human Versican. The host species for the production of this antibody is Mouse. The antigen used for immunization is Mouse Fusion protein amino acids 362-585 (glycosaminoglycan alpha domain) of mouse Versican core protein. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), ICC/IF (1:100). This MAb for Versican is conjugated with Streptavidin.

Monoclonal antibody for Versican

SMC-439S 0.012mg
EUR 78
Description: A monoclonal antibody from clone S351-23 against Human Versican. The host species for the production of this antibody is Mouse. The antigen used for immunization is Mouse Fusion protein amino acids 362-585 (glycosaminoglycan alpha domain) of mouse Versican core protein. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), ICC/IF (1:100). This MAb for Versican is not conjugated.

Monoclonal Human IgM Antibody

AMM03207G 0.1ml
EUR 580.8
Description: A Monoclonal antibody against Human Human IgM. The antibodies are raised in Mouse.

Human IGF-I monoclonal antibody

MAM1 500 µg
EUR 358.8

Human TGF-β2 monoclonal antibody

MAB1 500 µg
EUR 358.8

Monoclonal GR monoclonal antibody

AMM00029G 0.05mg
EUR 633.6
Description: A Monoclonal antibody against Human GR monoclonal. The antibodies are raised in Mouse. This antibody is applicable in WB, FC, E, IP

Pepsin (PP) Monoclonal Antibody (Human)

4-MAA632Hu22
  • EUR 310.80
  • EUR 3249.60
  • EUR 804.00
  • EUR 393.60
  • EUR 262.80
  • 100ul
  • 10ml
  • 1ml
  • 200ul
  • 20ul
Description: A Mouse monoclonal antibody against Human Pepsin (PP)

Titin (TTN) Monoclonal Antibody (Human)

4-MAB667Hu21
  • EUR 260.40
  • EUR 2457.60
  • EUR 624.00
  • EUR 321.60
  • EUR 241.20
  • 100ul
  • 10ml
  • 1ml
  • 200ul
  • 20ul
Description: A Mouse monoclonal antibody against Human Titin (TTN)

Klotho (KL) Monoclonal Antibody (Human)

4-MAH757Hu21
  • EUR 306.00
  • EUR 3170.40
  • EUR 786.00
  • EUR 386.40
  • EUR 260.40
  • 100ul
  • 10ml
  • 1ml
  • 200ul
  • 20ul
Description: A Mouse monoclonal antibody against Human Klotho (KL)

Human IGFBP-3 monoclonal antibody

MAK1 200 µg
EUR 358.8

Zyxin (ZYX) Monoclonal Antibody (Human)

4-MAC235Hu21
  • EUR 306.00
  • EUR 3170.40
  • EUR 786.00
  • EUR 386.40
  • EUR 260.40
  • 100ul
  • 10ml
  • 1ml
  • 200ul
  • 20ul
Description: A Mouse monoclonal antibody against Human Zyxin (ZYX)

Monoclonal TBP monoclonal antibody

APR13720G 0.1ml
EUR 633.6
Description: A Monoclonal antibody against Human TBP monoclonal. The antibodies are raised in Mouse. This antibody is applicable in WB

Midkine (MK) Monoclonal Antibody (Human)

4-MAA631Hu22
  • EUR 289.20
  • EUR 2900.40
  • EUR 724.80
  • EUR 361.20
  • EUR 253.20
  • 100ul
  • 10ml
  • 1ml
  • 200ul
  • 20ul
Description: A Mouse monoclonal antibody against Human Midkine (MK)

Leptin (LEP) Monoclonal Antibody (Human)

4-MAA084Hu21
  • EUR 285.60
  • EUR 2845.20
  • EUR 711.60
  • EUR 356.40
  • EUR 252.00
  • 100ul
  • 10ml
  • 1ml
  • 200ul
  • 20ul
Description: A Mouse monoclonal antibody against Human Leptin (LEP)

Leptin (LEP) Monoclonal Antibody (Human)

4-MAA084Hu22
  • EUR 285.60
  • EUR 2845.20
  • EUR 711.60
  • EUR 356.40
  • EUR 252.00
  • 100ul
  • 10ml
  • 1ml
  • 200ul
  • 20ul
Description: A Mouse monoclonal antibody against Human Leptin (LEP)

Monoclonal Rsf1 monoclonal antibody

AMM07673G 0.05mg
EUR 633.6
Description: A Monoclonal antibody against Human Rsf1 monoclonal. The antibodies are raised in Mouse. This antibody is applicable in WB and IF, IP