Monoclonal PP2A alpha and beta Antibody |
|||
AMM03147G | Leading Biology | 0.1ml | EUR 580.8 |
Description: A Monoclonal antibody against Human PP2A alpha and beta. The antibodies are raised in Mouse. This antibody is applicable in WB, IP |
Human Antibody Laboratories manufactures the human antibody versuse monoclonal antibody reagents distributed by Genprice. The Human Antibody Versuse Monoclonal Antibody reagent is RUO (Research Use Only) to test human serum or cell culture lab samples. To purchase these products, for the MSDS, Data Sheet, protocol, storage conditions/temperature or for the concentration, please contact human Antibody. Other Human products are available in stock. Specificity: Human Category: Antibody Group: Versuse Monoclonal
Monoclonal antibody for SUR1 and SUR2B |
||
Stressmarq | 0.1mg | EUR 471.6 |
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with Alkaline Phosphatase. |
Monoclonal antibody for SUR1 and SUR2B |
||
Stressmarq | 0.1mg | EUR 477.6 |
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with APC. |
Monoclonal antibody for SUR1 and SUR2B |
||
Stressmarq | 0.1mg | EUR 564 |
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with APC/Cy7. |
Monoclonal antibody for SUR1 and SUR2B |
||
Stressmarq | 0.1mg | EUR 474 |
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with Biotin. |
Monoclonal antibody for SUR1 and SUR2B |
||
Stressmarq | 0.1mg | EUR 495.6 |
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with Dylight 350. |
Monoclonal antibody for SUR1 and SUR2B |
||
Stressmarq | 0.1mg | EUR 482.4 |
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with Dylight 405. |
Monoclonal antibody for SUR1 and SUR2B |
||
Stressmarq | 0.1mg | EUR 470.4 |
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with Dylight 488. |
Versuse Monoclonal information
Monoclonal antibody for Versican |
|||
SMC-439D-RPE | Stressmarq | 0.1mg | EUR 475.2 |
Description: A monoclonal antibody from clone S351-23 against Human Versican. The host species for the production of this antibody is Mouse. The antigen used for immunization is Mouse Fusion protein amino acids 362-585 (glycosaminoglycan alpha domain) of mouse Versican core protein. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), ICC/IF (1:100). This MAb for Versican is conjugated with RPE. |
Monoclonal antibody for Versican |
|||
SMC-439D-STR | Stressmarq | 0.1mg | EUR 476.4 |
Description: A monoclonal antibody from clone S351-23 against Human Versican. The host species for the production of this antibody is Mouse. The antigen used for immunization is Mouse Fusion protein amino acids 362-585 (glycosaminoglycan alpha domain) of mouse Versican core protein. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), ICC/IF (1:100). This MAb for Versican is conjugated with Streptavidin. |
Monoclonal antibody for Versican |
|||
SMC-439S | Stressmarq | 0.012mg | EUR 78 |
Description: A monoclonal antibody from clone S351-23 against Human Versican. The host species for the production of this antibody is Mouse. The antigen used for immunization is Mouse Fusion protein amino acids 362-585 (glycosaminoglycan alpha domain) of mouse Versican core protein. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), ICC/IF (1:100). This MAb for Versican is not conjugated. |
Monoclonal Human IgM Antibody |
|||
AMM03207G | Leading Biology | 0.1ml | EUR 580.8 |
Description: A Monoclonal antibody against Human Human IgM. The antibodies are raised in Mouse. |
Human IGF-I monoclonal antibody |
|||
MAM1 | GroPep | 500 µg | EUR 358.8 |
Human TGF-β2 monoclonal antibody |
|||
MAB1 | GroPep | 500 µg | EUR 358.8 |
Monoclonal GR monoclonal antibody |
|||
AMM00029G | Leading Biology | 0.05mg | EUR 633.6 |
Description: A Monoclonal antibody against Human GR monoclonal. The antibodies are raised in Mouse. This antibody is applicable in WB, FC, E, IP |
Pepsin (PP) Monoclonal Antibody (Human) |
|||
4-MAA632Hu22 | Cloud-Clone |
|
|
Description: A Mouse monoclonal antibody against Human Pepsin (PP) |
Titin (TTN) Monoclonal Antibody (Human) |
|||
4-MAB667Hu21 | Cloud-Clone |
|
|
Description: A Mouse monoclonal antibody against Human Titin (TTN) |
Klotho (KL) Monoclonal Antibody (Human) |
|||
4-MAH757Hu21 | Cloud-Clone |
|
|
Description: A Mouse monoclonal antibody against Human Klotho (KL) |
Human IGFBP-3 monoclonal antibody |
|||
MAK1 | GroPep | 200 µg | EUR 358.8 |
Zyxin (ZYX) Monoclonal Antibody (Human) |
|||
4-MAC235Hu21 | Cloud-Clone |
|
|
Description: A Mouse monoclonal antibody against Human Zyxin (ZYX) |
Monoclonal TBP monoclonal antibody |
|||
APR13720G | Leading Biology | 0.1ml | EUR 633.6 |
Description: A Monoclonal antibody against Human TBP monoclonal. The antibodies are raised in Mouse. This antibody is applicable in WB |
Midkine (MK) Monoclonal Antibody (Human) |
|||
4-MAA631Hu22 | Cloud-Clone |
|
|
Description: A Mouse monoclonal antibody against Human Midkine (MK) |
Leptin (LEP) Monoclonal Antibody (Human) |
|||
4-MAA084Hu21 | Cloud-Clone |
|
|
Description: A Mouse monoclonal antibody against Human Leptin (LEP) |
Leptin (LEP) Monoclonal Antibody (Human) |
|||
4-MAA084Hu22 | Cloud-Clone |
|
|
Description: A Mouse monoclonal antibody against Human Leptin (LEP) |
Monoclonal Rsf1 monoclonal antibody |
|||
AMM07673G | Leading Biology | 0.05mg | EUR 633.6 |
Description: A Monoclonal antibody against Human Rsf1 monoclonal. The antibodies are raised in Mouse. This antibody is applicable in WB and IF, IP |