Monoclonal Anti-Spectrin(alpha and beta) Antibody Antibody |
GWB-BBB082 |
GenWay Biotech |
0.1 mg |
Ask for price |
Human Antibody Laboratories manufactures the human antibody versuse monoclonal antibody reagents distributed by Genprice. The Human Antibody Versuse Monoclonal Antibody reagent is RUO (Research Use Only) to test human serum or cell culture lab samples. To purchase these products, for the MSDS, Data Sheet, protocol, storage conditions/temperature or for the concentration, please contact human Antibody. Other Human products are available in stock. Specificity: Human Category: Antibody Group: Versuse Monoclonal
JBS True Blue |
MiTeGen |
300 µl |
EUR 16 |
Description: JBS True Blue |
Monoclonal Anti-Spectrin(alpha and beta) Antibody Antibody |
GenWay Biotech |
0.1 mg |
Ask for price |
Monoclonal antibody for SUR1 and SUR2B |
Stressmarq |
0.1mg |
EUR 423.6 |
|
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is not conjugated. |
Monoclonal antibody for SUR1 and SUR2B |
Stressmarq |
0.1mg |
EUR 480 |
|
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with ATTO 390. |
Monoclonal antibody for SUR1 and SUR2B |
Stressmarq |
0.1mg |
EUR 478.8 |
|
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with ATTO 488. |
Monoclonal antibody for SUR1 and SUR2B |
Stressmarq |
0.1mg |
EUR 478.8 |
|
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with ATTO 565. |
Monoclonal antibody for SUR1 and SUR2B |
Stressmarq |
0.1mg |
EUR 478.8 |
|
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with ATTO 594. |
Versuse Monoclonal information
Monoclonal antibody for Versican |
SMC-439D-DY594 |
Stressmarq |
0.1mg |
EUR 472.8 |
|
Description: A monoclonal antibody from clone S351-23 against Mouse Versican. The host species for the production of this antibody is Mouse. The antigen used for immunization is Mouse Fusion protein amino acids 362-585 (glycosaminoglycan alpha domain) of mouse Versican core protein. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), ICC/IF (1:100). This MAb for Versican is conjugated with Dylight 594. |
Monoclonal antibody for Versican |
SMC-439D-DY633 |
Stressmarq |
0.1mg |
EUR 466.8 |
|
Description: A monoclonal antibody from clone S351-23 against Mouse Versican. The host species for the production of this antibody is Mouse. The antigen used for immunization is Mouse Fusion protein amino acids 362-585 (glycosaminoglycan alpha domain) of mouse Versican core protein. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), ICC/IF (1:100). This MAb for Versican is conjugated with Dylight 633. |
Monoclonal antibody for Versican |
SMC-439D-P594 |
Stressmarq |
0.1mg |
EUR 487.2 |
|
Description: A monoclonal antibody from clone S351-23 against Mouse Versican. The host species for the production of this antibody is Mouse. The antigen used for immunization is Mouse Fusion protein amino acids 362-585 (glycosaminoglycan alpha domain) of mouse Versican core protein. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), ICC/IF (1:100). This MAb for Versican is conjugated with PE/ATTO 594. |
Monoclonal antibody for Versican |
SMC-439D-STR |
Stressmarq |
0.1mg |
EUR 476.4 |
|
Description: A monoclonal antibody from clone S351-23 against Human Versican. The host species for the production of this antibody is Mouse. The antigen used for immunization is Mouse Fusion protein amino acids 362-585 (glycosaminoglycan alpha domain) of mouse Versican core protein. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), ICC/IF (1:100). This MAb for Versican is conjugated with Streptavidin. |
Versican Rabbit monoclonal antibody |
BS40759 |
Bioworld Biotech |
50ul |
EUR 298 |
|
Description: Rabbit IgG, 1mg/ml in PBS with 0.02% sodium azide, 50% glycerol, pH7.2. |
Versican (9A7) Rabbit Monoclonal Antibody |
E28M3499 |
EnoGene |
100ul |
EUR 295 |
Versican (6Q14) Rabbit Monoclonal Antibody |
E28M2216 |
EnoGene |
100ul |
EUR 295 |
Versican (19Z6) Rabbit Monoclonal Antibody |
E28M2303 |
EnoGene |
100ul |
EUR 295 |
Versican (15C15) Rabbit Monoclonal Antibody |
E28M5694 |
EnoGene |
100ul |
EUR 295 |
Versican Rabbit Monoclonal Antibody [KD Validated] |
E46F62725 |
EnoGene |
40ul |
EUR 295 |
Human CD8 Monoclonal antibody |
8A1-100T |
ImmunoStep |
100 test |
EUR 259.6 |
Human CD8 Monoclonal antibody |
8AC750-100T |
ImmunoStep |
100 test |
EUR 446.6 |
Human CD8 Monoclonal antibody |
8F1-100T |
ImmunoStep |
100 test |
EUR 215.6 |
Human CD8 Monoclonal antibody |
8PE1-100T |
ImmunoStep |
100 test |
EUR 237.6 |
Human CD8 Monoclonal antibody |
8PPC5.5-100T |
ImmunoStep |
100 test |
EUR 358.6 |
Human CD9 Monoclonal antibody |
9A-100T |
ImmunoStep |
100 test |
EUR 303.6 |
Human CD9 Monoclonal antibody |
9B-01MG |
ImmunoStep |
100 test |
EUR 204.6 |
Human CD9 Monoclonal antibody |
9CFB-100T |
ImmunoStep |
100 test |
EUR 292.6 |
Human CD9 Monoclonal antibody |
9F-100T |
ImmunoStep |
100 test |
EUR 215.6 |
Human CD9 Monoclonal antibody |
9PE-100T |
ImmunoStep |
100 test |
EUR 259.6 |
Human CD9 Monoclonal antibody |
9PU-01MG |
ImmunoStep |
0,1 mg |
EUR 149.6 |
Human CD2 Monoclonal antibody |
2A-100T |
ImmunoStep |
100 test |
EUR 259.6 |
Human CD2 Monoclonal antibody |
2F-100T |
ImmunoStep |
100 test |
EUR 215.6 |
Human CD2 Monoclonal antibody |
2PE-100T |
ImmunoStep |
100 test |
EUR 259.6 |
Human CD3 Monoclonal antibody |
3A1-100T |
ImmunoStep |
100 test |
EUR 259.6 |
Human CD3 Monoclonal antibody |
3AC750-100T |
ImmunoStep |
100 test |
EUR 325.6 |
Human CD3 Monoclonal antibody |
3CFB1-100T |
ImmunoStep |
100 test |
EUR 292.6 |
Human CD3 Monoclonal antibody |
3F1-100T |
ImmunoStep |
100 test |
EUR 215.6 |